PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016480686.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 320aa    MW: 36364.3 Da    PI: 9.4122
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016480686.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.61.2e-12147191347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+ E++l++ + +++G+g+Wk+I+r+    +t+ q+ s+ qky
   XP_016480686.1 147 PWTEGEHQLFLMGLNRFGKGDWKSISRYYVVSKTPTQVASHAQKY 191
                      7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.9573187IPR017884SANT domain
SMARTSM007171.53285IPR001005SANT/Myb domain
SuperFamilySSF466891.5E-63587IPR009057Homeodomain-like
PROSITE profilePS5129415.494139196IPR017930Myb domain
SuperFamilySSF466896.13E-15141195IPR009057Homeodomain-like
SMARTSM007173.7E-8144194IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.8E-16145194IPR006447Myb domain, plants
PfamPF002493.0E-10147191IPR001005SANT/Myb domain
CDDcd001674.18E-8147192No hitNo description
Gene3DG3DSA:1.10.10.605.7E-8147191IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MEWPEFLERS NSQESTFGLF SATPQANEVV ARAVQWTPEE KQVFENALSV FNNPISPSFF  60
EYVASKLPHK PLEEIKKYYL ALFKDVEMEN PVPKNKAPAA NGYELDHDQQ HNYQVPQEDD  120
HSDMEAARNG TPPPVENNRP RRRRGIPWTE GEHQLFLMGL NRFGKGDWKS ISRYYVVSKT  180
PTQVASHAQK YFGRRNSATP PERRRPSIND IQTVTLNPRA TTVTAQINNG RLAPLNNNNQ  240
GSSSMPFHYP YNFGGAMFGH NSHGNYGSFV NRGEACGSNS INMQHNNDNN NNNNNLRRLV  300
LPRPFLSMCL ASATRNNNRV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016480686.10.0PREDICTED: transcription factor DIVARICATA-like
TrEMBLK4BAA96e-92K4BAA9_SOLLC; Uncharacterized protein
STRINGSolyc02g082390.1.12e-91(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52342032
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49010.11e-32MYB family protein